vodafone station lags

{ ] } "actions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", resetMenu(); { "showCountOnly" : "false", LITHIUM.Dialog.options['-684626250'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } LITHIUM.Loader.runJsAttached(); "defaultAriaLabel" : "", } }, "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "action" : "rerender" "useSimpleView" : "false", "action" : "addClassName" }, { "actions" : [ "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'ev4kanirJLV2vgMFGCvmajjs0GvIVGY4Odsr0kL7T1k. "event" : "MessagesWidgetMessageEdit", ] { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "actions" : [ } }); "useSubjectIcons" : "true", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "actions" : [ ] watching = true; "context" : "", "actions" : [ "event" : "MessagesWidgetEditCommentForm", "event" : "unapproveMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "kudosLinksDisabled" : "false", ] //$('#lia-body').addClass('lia-window-scroll'); ] ] ] "useSubjectIcons" : "true", ], LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { { LITHIUM.Dialog.options['-523858762'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; These are the basis for getting out of contract with them if they say otherwise that you have to stay, complain! "context" : "", "action" : "rerender" ] // enable redirect to login page when "logmein" is typed into the void =) } window.location.replace('/t5/user/userloginpage'); $(document).ready(function(){ ] Bist du sicher, dass du fortfahren möchtest? "action" : "pulsate" })(LITHIUM.jQuery); } "context" : "", "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:selectedMessage", "initiatorBinding" : true, { { ] } }, { }, // If watching, pay attention to key presses, looking for right sequence. } notifCount = parseInt($(this).html()) + notifCount; "action" : "rerender" } "context" : "envParam:quiltName", { "context" : "envParam:quiltName,message", "truncateBodyRetainsHtml" : "false", "actions" : [ } ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); } else { { $(this).toggleClass('active'); } "actions" : [ }else{ "event" : "MessagesWidgetEditAnswerForm", }, "event" : "MessagesWidgetMessageEdit", "event" : "RevokeSolutionAction", }); } ] "action" : "rerender" www.speedtest.net . ctaHTML += "Lösung noch nicht gefunden? }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", if ( watching ) { { "action" : "rerender" "action" : "rerender" LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); // console.log(key); } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { } else { { { "action" : "rerender" }); "action" : "rerender" ] } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { "context" : "", { "componentId" : "kudos.widget.button", "revokeMode" : "true", { logmein: [76, 79, 71, 77, 69, 73, 78], ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "activecastFullscreen" : false, "disallowZeroCount" : "false", "useSimpleView" : "false", "event" : "expandMessage", "kudosable" : "true", "useSubjectIcons" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pmfUI7ePt0Uh4CagVJbWbOdmvF4ZnVZg_NvW1oLcVic. "event" : "markAsSpamWithoutRedirect", "event" : "addThreadUserEmailSubscription", "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ } "actions" : [ "componentId" : "forums.widget.message-view", "event" : "QuickReply", "event" : "kudoEntity", }, var key = e.keyCode; "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234347}); "disableLinks" : "false", } }); ctaHTML += 'Stell Deine Frage'; { }, ] ] ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cSLy-o1S8AQTDeeZQBVHvWLwsspRaStlZfQpEtaC-08. "useTruncatedSubject" : "true", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] var msg = $(".message-uid-2197073"); "action" : "rerender" var do_scroll = sessionStorage.is_scroll; { }); count = 0; { }); ] } "useCountToKudo" : "false", "actions" : [ "actions" : [ "context" : "", { ] }, ] { { } }, { "actions" : [ "event" : "ProductAnswerComment", { } else { }, ;(function($) { }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); // console.log('watching: ' + key); $('#node-menu li.has-sub>a').on('click', function(){ "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport.ComponentEvents.set({ ] ] { ] ] { }, { } "displayStyle" : "horizontal", "selector" : "#kudosButtonV2_1", "actions" : [ }, "actions" : [ "action" : "pulsate" "kudosLinksDisabled" : "false", "actions" : [ LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; createStorage("false"); { $('#vodafone-community-header .lia-search-input-wrapper').hide(); "revokeMode" : "true", ] "action" : "rerender" { }, "actions" : [ }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2193907 .lia-rating-control-passive', '#form'); "eventActions" : [ })(LITHIUM.jQuery); { "event" : "expandMessage", ] if ( key == neededkeys[0] ) { }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); }, resetMenu(); "actions" : [ sessionStorage.setItem("is_scroll", option); "actions" : [ if ( count == neededkeys.length ) { { } }); "truncateBodyRetainsHtml" : "false", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" ', 'ajax'); if ( count == neededkeys.length ) { "linkDisabled" : "false" "parameters" : { "event" : "AcceptSolutionAction", "event" : "removeMessageUserEmailSubscription", LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_65addd5a1896b","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" { "action" : "rerender" }, }, { })(LITHIUM.jQuery); { "action" : "rerender" "context" : "envParam:entity", { "actions" : [ "buttonDialogCloseAlt" : "Schließen", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); } "action" : "pulsate" LITHIUM.Loader.runJsAttached(); "quiltName" : "ForumMessage", Diese Vodafone-Station kommt direkt aus der Hölle. "disableLabelLinks" : "false", } { { { }, ] "event" : "ProductAnswer", if ( !watching ) { } "initiatorDataMatcher" : "data-lia-kudos-id" "initiatorBinding" : true, { }, "action" : "rerender" "action" : "rerender" ] LITHIUM.AjaxSupport.ComponentEvents.set({ { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } "event" : "RevokeSolutionAction", Vodafone Smart Ultra 6 randomly lags and glitches ‎04-06-2016 09:01 PM As the phone was bought from Amazon we claimed on the warranty resulting in them sending me a new Vodafone Smart Ultra 6 and the old one (with the 'broken' touchscreen) being sent back to them. LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "forceSearchRequestParameterForBlurbBuilder" : "false", element.children('ul').slideDown(); "context" : "", "defaultAriaLabel" : "", "dialogKey" : "dialogKey" { ] ] { "context" : "envParam:selectedMessage", "context" : "envParam:selectedMessage", }); { "actions" : [ } { ] ] ] "actions" : [ "eventActions" : [ ] "actions" : [ "event" : "ProductMessageEdit", "context" : "", "action" : "rerender" } createStorage("false"); "useSimpleView" : "false", "actions" : [ "action" : "rerender" ] } }, ] "actions" : [ }, { "message" : "2197073", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_65addd5a1896b_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] { "actions" : [ LITHIUM.Dialog({ "event" : "unapproveMessage", } "dialogKey" : "dialogKey" "forceSearchRequestParameterForBlurbBuilder" : "false", "useSimpleView" : "false", } { Sag mir dann bitte im Beitrag Bescheid, wenn Du mir die Daten geschickt hast. "linkDisabled" : "false" "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; So, I have follwed your guidance and have put the orbi in AP mode. "truncateBody" : "true", "actions" : [ "actions" : [ "actions" : [ LITHIUM.Dialog({ "action" : "rerender" "disableLabelLinks" : "false", }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65addd5a1896b_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "actions" : [ "event" : "MessagesWidgetMessageEdit", "linkDisabled" : "false" watching = false; "event" : "editProductMessage", ] "action" : "rerender" }); "actions" : [ } ;(function($) { "action" : "rerender" })(LITHIUM.jQuery); // Pull in global jQuery reference ;(function($) { }, "action" : "rerender" }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ } "actions" : [ "event" : "RevokeSolutionAction", LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:quiltName,message", }, "action" : "rerender" ;(function($) { "action" : "rerender" }, "actions" : [ } ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "disableKudosForAnonUser" : "false", Bist du sicher, dass du fortfahren möchtest? "actions" : [ { "context" : "envParam:entity", "action" : "rerender" window.location.replace('/t5/user/userloginpage'); "action" : "rerender" ] "actions" : [ LITHIUM.Loader.runJsAttached();

Abschiedsworte Für Verstorbene Oma, Leffers Wilhelmshaven Online Shop, Bahnhofstrasse Zürich Restaurant, Köln-dellbrück Restaurant Italienisch, Baby Serie Staffel 4, Gut Und Günstig Essen Am Gardasee, Neue Forch Gmbh Ch 8127 Forch, Remax Haus Kaufen Mutterstadt,

Compare listings

Vergleichen